Recombinant Human QTRTD1 protein (ab187456)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMKLSLTKVVNGCRLGKIKNLGKTGDHT MDIPGCLLYTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEY KEGVGKFIGMPESLLYCSLHDPVSPCPAGYVTNKSVSVWSVAGRVEMTVS KFMAIQKALQPDWFQCLSDGEVSCKEATSIKRVRKSVDRSLLFLDNCLRL QEESEVLQKSVIIGVIEGGDVMEERLRSARETAKRPVGGFLLDGFQGNPT TLEARLRLLSSVTAELPEDKPRLISGVSRPDEVLECIERGVDLFESFFPY QVTERGCALTFSFDYQPNPEETLLQQNGTQEEIKCMDQIKKIETTGCNQE ITSFEINLKEKKYQEDFNPLVRGCSCYCCKNHTRAYIHHLLVTNELLAGV LLMMHNFEHYFGFFHYIREALKSDKLAQLKELIHRQAS
    • Molecular weight
      49 kDa including tags
    • Amino acids
      1 to 415
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab187456 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >95% by SDS-PAGE .
    ab187456 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 30% Glycerol, 0.03% DTT, 0.03% EDTA, 0.002% PMSF, 69% PBS

General Info

  • Alternative names
    • FLJ12960
    • QTRD1_HUMAN
    • qtrtd1
    • queuine tRNA ribosyltransferase domain containing 1
    • Queuine tRNA-ribosyltransferase domain-containing protein 1
    • Queuine tRNA-ribosyltransferase subunit qtrtd1
    see all
  • Function
    Interacts with QTRT1 to form an active queuine tRNA-ribosyltransferase. This enzyme exchanges queuine for the guanine at the wobble position of tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr), thereby forming the hypermodified nucleoside queuosine (Q) (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).
  • Pathway
    tRNA modification; tRNA-queuosine biosynthesis.
  • Sequence similarities
    Belongs to the queuine tRNA-ribosyltransferase family. QTRTD1 subfamily.
  • Cellular localization
    Cytoplasm. Mitochondrion. May associate with the mitochondrion outer membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab187456 (3 µg)

References

ab187456 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187456.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up