Recombinant Human Quiescin Q6 protein (ab114732)

Overview

  • Product nameRecombinant Human Quiescin Q6 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO00391
    • SpeciesHuman
    • SequenceKALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPTVRFFKAFTKN GSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFF
    • Molecular weight37 kDa including tags
    • Amino acids81 to 180

Specifications

Our Abpromise guarantee covers the use of ab114732 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ34858
    • hQSOX
    • Human quiescin (Q6) mRNA, partial cds
    • Q6
    • QSCN6
    • QSOX1
    • QSOX1_HUMAN
    • Quiescin Q6
    • Quiescin Q6 sulfhydryl oxidase 1
    • Skin sulfhydryl oxidase
    • Sox
    • Sulfhydryl oxidase 1
    • Sulfhydryl oxidase 1 precursor
    see all
  • FunctionCatalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides with the reduction of oxygen to hydrogen peroxide. May contribute to disulfide bond formation in a variety of secreted proteins. In fibroblasts, it may have tumor-suppressing capabilities being involved in growth regulation.
  • Tissue specificityExpressed in heart, placenta, lung, liver, skeletal muscle, pancreas and very weakly in brain and kidney.
  • Sequence similaritiesBelongs to the quiescin-sulfhydryl oxidase (QSOX) family.
    Contains 1 ERV/ALR sulfhydryl oxidase domain.
    Contains 1 thioredoxin domain.
  • Cellular localizationGolgi apparatus membrane and Secreted > extracellular space. Found in the extracellular medium of quiescent cells but is not found in proliferating cells.
  • Information by UniProt

Recombinant Human Quiescin Q6 protein images

  • 12.5% SDS-PAGE showing ab114732 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Quiescin Q6 protein (ab114732)

ab114732 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114732.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"