Recombinant Human Quiescin Q6 protein (ab114732)

Overview

  • Product name
    Recombinant Human Quiescin Q6 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPTVRFFKAFTKN GSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFF
    • Molecular weight
      37 kDa including tags
    • Amino acids
      81 to 180

Specifications

Our Abpromise guarantee covers the use of ab114732 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ34858
    • hQSOX
    • Human quiescin (Q6) mRNA, partial cds
    • Q6
    • QSCN6
    • QSOX1
    • QSOX1_HUMAN
    • Quiescin Q6
    • Quiescin Q6 sulfhydryl oxidase 1
    • Skin sulfhydryl oxidase
    • Sox
    • Sulfhydryl oxidase 1
    • Sulfhydryl oxidase 1 precursor
    see all
  • Function
    Catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides with the reduction of oxygen to hydrogen peroxide. May contribute to disulfide bond formation in a variety of secreted proteins. In fibroblasts, it may have tumor-suppressing capabilities being involved in growth regulation.
  • Tissue specificity
    Expressed in heart, placenta, lung, liver, skeletal muscle, pancreas and very weakly in brain and kidney.
  • Sequence similarities
    Belongs to the quiescin-sulfhydryl oxidase (QSOX) family.
    Contains 1 ERV/ALR sulfhydryl oxidase domain.
    Contains 1 thioredoxin domain.
  • Cellular localization
    Golgi apparatus membrane and Secreted > extracellular space. Found in the extracellular medium of quiescent cells but is not found in proliferating cells.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114732 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References

ab114732 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114732.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up