Recombinant Human RAB11-FIP2 protein (ab153189)

Overview

  • Product name
    Recombinant Human RAB11-FIP2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MMLSEQAQKWFPTHVQVTVLQAKDLKPKGKSGTNDTYTIIQLGKEKYSTS VAEKTLEPVWKEEASFELPGLLIQGSPEKYILFLIVMHRSLVGLDKFLGQ VAINLNDIFEDKQRRKTEWFRLESKQGKRIKNRGEIKVNIQFMRNNMTAS MFDLSMKDKTRSPFAKLKDKMKGRKNDGTFSDTSSAIIPSTHMPDANSEF SSGEIQMKSKPKKPFLLGPQRLSSAHSMSDLSGSHMSSEKLKAGTIGQTH LLGHQLDSFGTVPESGSLKSPHRRTLSFDTSKMNQPDSIVDEGELCFGRQ NDPFTNVTASLPQKFATLPRKKNPFEESSETWDSSMNLFSKPIEIRKENK REKREKVSLFERVTGKKDSRRSDKLNNGGSDSPCDLKSPNAFSENRQDYF DYESTNPFTAKFRASNIMPSSSFHMSPTSNEDLRKIPDSNPFDATAGYRS LTYEEVLQELVKHKELLRRKDTHIRELEDYIDNLLVRVMEETPSILRVPY EPSRKAGKFSNS
    • Amino acids
      1 to 512
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153189 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA0941
    • NRip11
    • RAB11 family interacting protein 2 (class I)
    • Rab11 family-interacting protein 2
    • RAB11 FIP2 long isoform
    • Rab11-FIP2
    • RAB11FIP2
    • RFIP2
    • RFIP2_HUMAN
    see all
  • Function
    A Rab11 effector binding preferentially phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and phosphatidic acid (PA) and acting in the regulation of the transport of vesicles from the endosomal recycling compartment (ERC) to the plasma membrane. Involved in insulin granule exocytosis. Also involved in receptor-mediated endocytosis and membrane trafficking of recycling endosomes, probably originating from clathrin-coated vesicles. Required in a complex with MYO5B and RAB11 for the transport of NPC1L1 to the plasma membrane. Also acts as a regulator of cell polarity.
  • Sequence similarities
    Contains 1 C2 domain.
    Contains 1 FIP-RBD domain.
  • Post-translational
    modifications
    Phosphorylation at Ser-227 by MARK2 regulates epithelial cell polarity.
  • Cellular localization
    Cell membrane. Recycling endosome membrane. Translocates with RAB11A from the vesicles of the endocytic recycling compartment (ERC) to the plasma membrane.
  • Information by UniProt

Images

  • ab153189 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153189 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153189.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up