Recombinant Human RAB11FIP1 protein (ab164227)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PRLHPVKPMNATATKVANCSLGTATIISENLNNEVMMKKYSPSDPAFAYA QLTHDELIQLVLKQKETISKKEFQVRELEDYIDNLLVRVMEETPNILRIP TQVGKKAGKM
    • Amino acids
      540 to 649
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164227 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ22524
    • FLJ22622
    • HGNC:30265
    • MGC78448
    • No Rab11 binding protein 1A
    • NOEL1A
    • Rab coupling protein
    • Rab effector protein
    • Rab interacting recycling protein
    • Rab-coupling protein
    • RAB11 family interacting protein 1 (class I)
    • Rab11 family interacting protein 1D
    • Rab11 family-interacting protein 1
    • Rab11 FIP1
    • Rab11-FIP1
    • RAB11FIP1
    • RCP
    • RFIP1_HUMAN
    see all
  • Function
    A Rab11 effector protein involved in the endosomal recycling process. Also involved in controlling membrane trafficking along the phagocytic pathway and in phagocytosis.
  • Tissue specificity
    Isoform 2 is expressed in brain, heart, testis, lung, spleen, ovary and small intestine.
  • Sequence similarities
    Contains 1 C2 domain.
    Contains 1 FIP-RBD domain.
  • Cellular localization
    Recycling endosome. Rab11A rather than Rab4A mediates localization in the endocytic recycling compartment (ERC) and Cytoplasmic vesicle, phagosome membrane. Membrane-bound (isoform 2). Colocalizes with Rab11A at phagosomes (isoform 2).
  • Information by UniProt

Images

  • ab164227 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164227 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164227.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up