Recombinant Human RAB11FIP5 protein (ab161886)

Overview

  • Product name
    Recombinant Human RAB11FIP5 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SGLEKLKTVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHLTHD ELISLLLQRERELSQRDEHVQELESYIDRLLVRIMETSPTLLQIPPGPP
    • Amino acids
      554 to 652
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GAF 1
    • Gaf-1
    • GAF1
    • gamma SNAP associated factor 1
    • Gamma-SNAP-associated factor 1
    • KIAA0857
    • Phosphoprotein pp75
    • pp75
    • RAB11 family interacting protein 5 (class I)
    • Rab11 family-interacting protein 5
    • Rab11 FIP5
    • Rab11 interacting protein
    • Rab11 interacting protein Rip11
    • Rab11-FIP5
    • Rab11-interacting protein Rip11
    • Rab11fip5
    • RFIP5_HUMAN
    • RIP11
    see all
  • Function
    Rab effector involved in protein trafficking from apical recycling endosomes to the apical plasma membrane.
  • Tissue specificity
    Detected at low levels in heart, brain, placenta, lung, liver, adipocytes, kidney, spleen, skeletal muscle and pancreas.
  • Sequence similarities
    Contains 1 C2 domain.
    Contains 1 FIP-RBD domain.
  • Domain
    Binds to vesicles enriched in neutral phospholipids via its C2 domain. The interaction is favored by Mg(2+) rather than Ca(2+).
  • Post-translational
    modifications
    Phosphorylated on serine and threonine residues.
  • Cellular localization
    Cytoplasm. Recycling endosome membrane. Mitochondrion membrane.
  • Information by UniProt

Images

  • ab161886 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161886 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up