Overview

  • Product name
    Recombinant Human RAB13 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAKAYDHLFKLLLIGDSGVGKTCLIIRFAE DNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRG AMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRK VQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGN GNKPPSTDLKTCDKKNTNKC
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 200
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab109958 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 20% Glycerol, 0.32% Tris HCl, 0.02% DTT, 1.17% Sodium chloride, 0.03% EDTA

General Info

  • Alternative names
    • Cell growth-inhibiting gene 4 protein
    • GIG4
    • Growth inhibiting gene 4 protein
    • RAB13
    • RAB13 member RAS oncogene family
    • RAB13_HUMAN
    • RAS associated protein RAB13
    • Ras related protein Rab13
    • Ras-related protein Rab-13
    see all
  • Function
    Could participate in polarized transport, in the assembly and/or the activity of tight junctions.
  • Tissue specificity
    Detected in several types of epithelia, including intestine, kidney, liver and in endothelial cells.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization
    Cell junction > tight junction. Cell membrane. Cytoplasmic vesicle membrane. Cytoplasmic tight junctions or associated with vesicles scattered throughout the cytoplasm in cells lacking tight junctions.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab109958.

References

ab109958 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up