Overview

  • Product name
    Recombinant Human RAB13 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAKAYDHLFKLLLIGDSGVGKTCLIIRFAE DNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRG AMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRK VQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGN GNKPPSTDLKTCDKKNTNKC
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 200
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab109958 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 20% Glycerol, 0.32% Tris HCl, 0.02% DTT, 1.17% Sodium chloride, 0.03% EDTA

General Info

  • Alternative names
    • Cell growth-inhibiting gene 4 protein
    • GIG4
    • Growth inhibiting gene 4 protein
    • RAB13
    • RAB13 member RAS oncogene family
    • RAB13_HUMAN
    • RAS associated protein RAB13
    • Ras related protein Rab13
    • Ras-related protein Rab-13
    see all
  • Function
    Could participate in polarized transport, in the assembly and/or the activity of tight junctions.
  • Tissue specificity
    Detected in several types of epithelia, including intestine, kidney, liver and in endothelial cells.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization
    Cell junction > tight junction. Cell membrane. Cytoplasmic vesicle membrane. Cytoplasmic tight junctions or associated with vesicles scattered throughout the cytoplasm in cells lacking tight junctions.
  • Information by UniProt

Recombinant Human RAB13 protein images

  • 15% SDS-PAGE analysis of 3 µg ab109958.

References for Recombinant Human RAB13 protein (ab109958)

ab109958 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up