Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP61106
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMATAPYNYSYIFKYIIIGDMGVGKSCL LHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVT RSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKAD LEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQ DGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC
    • Molecular weight26 kDa including tags
    • Amino acids1 to 215
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab109832 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.58% Sodium chloride, 0.32% Tris HCl, 0.02% DTT, pH 8.0

General Info

  • Alternative names
    • bA165P4.3
    • F protein binding protein 1
    • FBP
    • GTPase Rab14
    • RAB 14
    • RAB14
    • RAB14 member RAS oncogene family
    • RAB14_HUMAN
    • Ras related protein Rab 14
    • Ras-related protein Rab-14
    • RP11 165P4.4
    • Small GTP binding protein RAB14
    see all
  • FunctionMay be involved in vesicular trafficking and neurotransmitter release.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Rab family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human RAB14 protein images

  • 15% SDS-PAGE image, using ab109832 at 3ug.

References for Recombinant Human RAB14 protein (ab109832)

ab109832 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109832.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"