Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAQAHRTPQPRAAPSQPRVFKLVLLGSGSV GKSSLALRYVKNDFKSILPTVGCAFFTKVVDVGATSLKLEIWDTAGQEKY HSVCHLYFRGANAALLVYDITRKDSFLKAQQWLKDLEEELHPGEVLVMLV GNKTDLSQEREVTFQEGKEFADSQKLLFMETSAKLNHQVSEVFNTVAQEL LQRSDEEGQALRGDAAVALNKGPARQAKCCAH
    • Molecular weight
      26 kDa
    • Amino acids
      1 to 212
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109833 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab109833 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 30% Glycerol, 0.32% Tris HCl, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • AW413472
    • FLJ12538
    • OTTHUMP00000164417
    • OTTHUMP00000202805
    • Rab 17
    • Rab17
    • RAB17 member RAS oncogene family
    • RAB17_HUMAN
    • Ras related protein Rab 17
    • Ras related protein Rab17
    • Ras-related protein Rab-17
    see all
  • Function
    Might be involved in transcellular transport.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human Rab17 protein images

  • 15% SDS-PAGE image, ab109833 used at 3ug

References for Recombinant Human Rab17 protein (ab109833)

ab109833 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109833.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up