Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP61019
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHSGSHMAYAYLFKYIIIGDTGVGKSCLLLQF TDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYY RGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESR REVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVF DINNEANGIKIGPQHAATNATHAGNQGGQQAGGGCC
    • Molecular weight26 kDa including tags
    • Amino acids1 to 212
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109843 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab109843 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 9330148M11Rik
    • C80220
    • GTP binding protein
    • LHX
    • OTTMUSP00000004796
    • RAB2
    • RAB2 member RAS oncogene family
    • RAB2A
    • RAB2A, member RAS oncogene family
    • RAB2A_HUMAN
    • Ras related protein Rab 2A
    • RAS-associated protein RAB2
    • Ras-related protein Rab-2A
    • RP23-183L6.1
    • Small GTP binding protein RAB2A
    see all
  • FunctionRequired for protein transport from the endoplasmic reticulum to the Golgi complex.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Rab family.
  • Cellular localizationEndoplasmic reticulum-Golgi intermediate compartment membrane. Melanosome. Endoplasmic reticulum membrane. Golgi apparatus membrane. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Recombinant Human Rab2 protein images

  • 15% SDS-PAGE showing ab109843 at approximately 26.1kDa (3µg).

References for Recombinant Human Rab2 protein (ab109843)

ab109843 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109843.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"