Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ969Q5
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMSGQRVDVKVVMLGKEYVGKTSLVER YVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERYEAMSRI YYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLE EDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVA AFQVMTEDKGVDLGQKPNPYFYSCCHH
    • Molecular weight26 kDa including tags
    • Amino acids1 to 227
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab113161 was purified by using conventional chromatography techniques
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.03% DTT, 30% Glycerol, 0.58% Sodium chloride, 0.03% EDTA

General Info

  • Alternative names
    • OTTHUMP00000161435
    • OTTHUMP00000161437
    • OTTHUMP00000223588
    • Rab 24
    • RAB24
    • RAB24, member RAS oncogene family
    • RAB24_HUMAN
    • Ras related protein Rab 24
    • Ras-related protein Rab-24
    see all
  • FunctionMay be involved in autophagy-related processes.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Rab family.
  • Post-translational
    modifications
    Isoprenylation is inefficient compared to other Rab family members.
  • Cellular localizationCytoplasm > cytosol. Membrane. Only about 20-25% is recovered in the particulate fraction.
  • Information by UniProt

Recombinant Human Rab24 protein images

  • ab113161 at 3 µg analysed by 15% SDS PAGE.

References for Recombinant Human Rab24 protein (ab113161)

ab113161 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113161.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"