Recombinant Human Rab24 protein (Tagged) (ab216226)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHENLYFQGGEFSGQRVDVKVVMLGKEYVGKTS LVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERYEA MSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKS DLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDY VSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH
    • Molecular weight
      26 kDa including tags
    • Amino acids
      1 to 203
    • Additional sequence information
      Expressed with a small T7-His-TEV cleavage site Tag (29 aa) fusion at its N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab216226 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, sucrose and DTT.

General Info

  • Alternative names
    • OTTHUMP00000161435
    • OTTHUMP00000161437
    • OTTHUMP00000223588
    • Rab 24
    • RAB24
    • RAB24, member RAS oncogene family
    • RAB24_HUMAN
    • Ras related protein Rab 24
    • Ras-related protein Rab-24
    see all
  • Function
    May be involved in autophagy-related processes.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rab family.
  • Post-translational
    modifications
    Isoprenylation is inefficient compared to other Rab family members.
  • Cellular localization
    Cytoplasm > cytosol. Membrane. Only about 20-25% is recovered in the particulate fraction.
  • Information by UniProt

References

ab216226 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216226.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up