Recombinant Human RAB27B protein (ab102702)

Overview

  • Product name
    Recombinant Human RAB27B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMTDGDYDYLIKLLALGDSGVGKTTFLYRYT DNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQER FRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVL IGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDL IMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
    • Molecular weight
      27 kDa
    • Amino acids
      1 to 218
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102702 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • C25KG
    • Rab27b
    • RAB27B member RAS oncogene family
    • RAS associated protein RAB27B
    • Ras related protein Rab 27b
    • Ras related protein Rab27b
    • Ras-related protein Rab-27B
    • RB27B_HUMAN
    • Small GTP binding protein rab27b
    see all
  • Function
    May be involved in targeting uroplakins to urothelial apical membranes.
  • Tissue specificity
    Expressed primarily in testis.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab102702 at approximately 26.7kDa (3µg).

References

ab102702 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102702.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up