Recombinant Human RAB27B protein (ab102702)

Overview

  • Product name
    Recombinant Human RAB27B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMTDGDYDYLIKLLALGDSGVGKTTFLYRYT DNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQER FRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVL IGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDL IMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
    • Molecular weight
      27 kDa
    • Amino acids
      1 to 218
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102702 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • C25KG
    • Rab27b
    • RAB27B member RAS oncogene family
    • RAS associated protein RAB27B
    • Ras related protein Rab 27b
    • Ras related protein Rab27b
    • Ras-related protein Rab-27B
    • RB27B_HUMAN
    • Small GTP binding protein rab27b
    see all
  • Function
    May be involved in targeting uroplakins to urothelial apical membranes.
  • Tissue specificity
    Expressed primarily in testis.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human RAB27B protein images

  • 15% SDS-PAGE showing ab102702 at approximately 26.7kDa (3µg).

References for Recombinant Human RAB27B protein (ab102702)

ab102702 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102702.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up