Overview

  • Product nameRecombinant Human RAB2B protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ8WUD1
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMTYAYLFKYIIIGDTGVGKSCLLLQF TDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQESFRSITRSYY RGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESR RDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLF DVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGSNSGCC
    • Molecular weight27 kDa including tags
    • Amino acids1 to 216
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116205 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab116205 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride

General Info

  • Alternative names
    • FLJ14824
    • GTP binding protein RAB2B
    • GTP-binding protein RAB2B
    • RAB2B
    • RAB2B member RAS oncogene family
    • RAB2B_HUMAN
    • RAS family, member RAB2B
    • ras related protein Rab 2B
    • ras related protein Rab2B
    • Ras-related protein Rab-2B
    see all
  • FunctionRequired for protein transport from the endoplasmic reticulum to the Golgi complex.
  • Tissue specificityExpressed in kidney, prostate, lung, liver, thymus, colon, pancreas, and skeletal muscle, and low levels in placenta. Not detected in heart, brain, spleen, testis, ovary, small intestine and leukocyte.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Rab family.
  • Cellular localizationCell membrane. Endoplasmic reticulum membrane. Golgi apparatus membrane.
  • Information by UniProt

Recombinant Human RAB2B protein images

  • 15% SDS-PAGE analysis of 3 µg ab116205.

References for Recombinant Human RAB2B protein (ab116205)

ab116205 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116205.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"