Overview

  • Product name
    Recombinant Human RAB2B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMTYAYLFKYIIIGDTGVGKSCLLLQF TDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQESFRSITRSYY RGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESR RDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLF DVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGSNSGCC
    • Molecular weight
      27 kDa including tags
    • Amino acids
      1 to 216
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116205 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab116205 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride

General Info

  • Alternative names
    • FLJ14824
    • GTP binding protein RAB2B
    • GTP-binding protein RAB2B
    • RAB2B
    • RAB2B member RAS oncogene family
    • RAB2B_HUMAN
    • RAS family, member RAB2B
    • ras related protein Rab 2B
    • ras related protein Rab2B
    • Ras-related protein Rab-2B
    see all
  • Function
    Required for protein transport from the endoplasmic reticulum to the Golgi complex.
  • Tissue specificity
    Expressed in kidney, prostate, lung, liver, thymus, colon, pancreas, and skeletal muscle, and low levels in placenta. Not detected in heart, brain, spleen, testis, ovary, small intestine and leukocyte.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization
    Cell membrane. Endoplasmic reticulum membrane. Golgi apparatus membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab116205.

References

ab116205 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116205.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up