Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ13637
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMAGGGAGDPGLGAAAAPAPETREHLF KVLVIGELGVGKTSIIKR YVHQLFSQHYRATIGVDFALKVLNWDSRTL VRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLK WKS DLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFE TSAKDNINIEEAARFLVEKILV NHQSFPNEENDVDKIKLDQETLRAEN KSQCC
    • Molecular weight28 kDa including tags
    • Amino acids1 to 225
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab113131 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.08% DTT, 50% Glycerol, 1.17% Sodium chloride, 0.06% EDTA

General Info

  • Alternative names
    • RAB32
    • RAB32, member RAS oncogene family
    • RAB32_HUMAN
    • Ras related protein Rab32
    • Ras-related protein Rab-32
    see all
  • FunctionActs as an A-kinase anchoring protein by binding to the type II regulatory subunit of protein kinase A and anchoring it to the mitochondrion. Also involved in synchronization of mitochondrial fission.
  • Tissue specificityWidely expressed with high levels in heart, liver, kidney, bone marrow, testis, colon and fetal lung.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Rab family.
  • Cellular localizationMitochondrion.
  • Information by UniProt

Recombinant Human RAB32 protein images

  • 15% SDS-PAGE analysis of 3 µg ab113131.

References for Recombinant Human RAB32 protein (ab113131)

ab113131 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113131.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"