Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMAGGGAGDPGLGAAAAPAPETREHLF KVLVIGELGVGKTSIIKR YVHQLFSQHYRATIGVDFALKVLNWDSRTL VRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLK WKS DLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFE TSAKDNINIEEAARFLVEKILV NHQSFPNEENDVDKIKLDQETLRAEN KSQCC
    • Molecular weight
      28 kDa including tags
    • Amino acids
      1 to 225
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113131 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.08% DTT, 50% Glycerol, 1.17% Sodium chloride, 0.06% EDTA

General Info

  • Alternative names
    • RAB32
    • RAB32, member RAS oncogene family
    • RAB32_HUMAN
    • Ras related protein Rab32
    • Ras-related protein Rab-32
    see all
  • Function
    Acts as an A-kinase anchoring protein by binding to the type II regulatory subunit of protein kinase A and anchoring it to the mitochondrion. Also involved in synchronization of mitochondrial fission.
  • Tissue specificity
    Widely expressed with high levels in heart, liver, kidney, bone marrow, testis, colon and fetal lung.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab113131.

References

ab113131 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113131.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up