Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9BZG1
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMNILAPVRRDRVLAELPQCLRKEAALHGHK DFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLINRFCKDTFDKN YKATIGVDFEMERFEVLGIPFSLQLWDTAGQERFKCIASTYYRGAQAIII VFNLNDVASLEHTKQWLADALKENDPSSVLLFLVGSKKDLSTPAQYALME KDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGA RRIGDVVRINSDDSNLYLTASKKKPTCCP
    • Molecular weight31 kDa including tags
    • Amino acids1 to 259
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115717 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab115717 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 40% Glycerol, 0.02% DTT, 0.58% Sodium chloride

General Info

  • Alternative names
    • Rab-39
    • RAB34
    • RAB34, member RAS oncogene family
    • RAB34_HUMAN
    • RAB39
    • RAH
    • Ras-related protein Rab-34
    • Ras-related protein Rab-39
    • Ras-related protein Rah
    see all
  • FunctionProtein transport. Involved in the redistribution of lysosomes to the peri-Golgi region.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Rab family.
  • Cellular localizationCytoplasm. Golgi apparatus. Associates with the Golgi complex.
  • Information by UniProt

Recombinant Human Rab34 protein images

  • 15% SDS-PAGE showing ab115717 (3µg).

References for Recombinant Human Rab34 protein (ab115717)

ab115717 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab115717.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"