Overview

  • Product nameRecombinant Human RAB35 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ15286
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMARDYDHLFKLLIIGDSGVGKSSLLLRFAD NTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRG THGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVV ETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQ QQQQNDVVKLTKNSKRKKRCC
    • Molecular weight25 kDa including tags
    • Amino acids1 to 201
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113586 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab113586 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • GTP binding protein RAY
    • GTP-binding protein RAY
    • H ray
    • OTTHUMP00000240256
    • OTTHUMP00000240257
    • OTTHUMP00000240258
    • OTTHUMP00000240259
    • RAB1C
    • Rab35
    • RAB35 member RAS oncogene family
    • RAB35, member RAS oncogene family
    • RAB35_HUMAN
    • Ras related protein Rab 1C
    • Ras related protein rab 1c (GTP binding protein ray)
    • Ras related protein Rab35
    • Ras-related protein Rab-1C
    • Ras-related protein Rab-35
    • RAY
    see all
  • FunctionIn the process of endocytosis, essential rate-limiting regulator of a fast recycling pathway back to the plasma membrane. During cytokinesis, required for the postfurrowing terminal steps, namely for intercellular bridge stability and abscission, possibly by controlling phosphatidylinositol 4,5-bis phosphate (PIP2) and SEPT2 localization at the intercellular bridge.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Rab family.
  • Cellular localizationCell membrane. Membrane > clathrin-coated pit. Cytoplasmic vesicle > clathrin-coated vesicle. Endosome. Melanosome. Present on sorting endosomes and endosomal tubules. Tends to be enriched in PIP2-positive cell membrane domains. During mitosis, associated with the plasma membrane and present at the ingressing furrow during early cytokinesis as well as at the intercellular bridge later during cytokinesis. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Recombinant Human RAB35 protein images

  • 15% SDS-PAGE analysis of 3 µg ab113586.

References for Recombinant Human RAB35 protein (ab113586)

ab113586 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113586.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"