Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENI NIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAKS
    • Amino acids
      115 to 211
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161749 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Antigen NY MEL 1
    • Melanoma antigen NY MEL 1
    • Melanoma antigen NY-MEL-1
    • NY MEL 1
    • RAB 38
    • Rab related GTP binding protein
    • Rab38
    • RAB38 member RAS oncogene family
    • RAB38_HUMAN
    • Ras related protein Rab 38
    • Ras-related protein Rab-38
    • rrGTPbp
    see all
  • Function
    May be involved in melanosomal transport and docking. Involved in the proper sorting of TYRP1.
  • Tissue specificity
    Expressed in melanocytes.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rab family.
  • Post-translational
    modifications
    Although at least one in vitro system can process and methylate the prenylated C-terminal, in an in vitro system that normally express Rab-38 and in vivo the prenylated C-terminal is not proteolytically processed and not methylated.
  • Cellular localization
    Cell membrane. Melanosome.
  • Information by UniProt

Images

  • ab161749 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161749 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161749.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up