Overview

  • Product name
    Recombinant Human RAB39 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      METIWIYQFRLIVIGDSTVGKSCLLRRFTQGRFPGLRSPACDPTVGVDFF SRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRS FEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTREEAEKLSADCG MKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPN AVHSSEEAVKPRKECFC
    • Amino acids
      1 to 217
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162824 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • rab related GTP binding protein
    • Rab-39
    • Rab39
    • RAB39A
    • RAB39A member RAS oncogene family
    • Ras related protein Rab39A
    • Ras-related protein Rab-39A
    • RB39A_HUMAN
    see all
  • Function
    May be involved in vesicular trafficking.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab162824 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162824 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162824.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up