Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP20336
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMASATDSRYGQKESSDQNFDYMFKILIIGN SSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAG QERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQV LLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLV DVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC
    • Molecular weight27 kDa including tags
    • Amino acids1 to 220
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109964 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab109964 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Rab 3A
    • RAB 3A member RAS oncogene family
    • Rab3a
    • RAB3A member RAS oncogene family
    • RAB3A_HUMAN
    • RAS associated protein RAB 3A
    • RAS associated protein RAB3A
    • Ras related protein Rab 3A
    • Ras related protein Rab3A
    • Ras-related protein Rab-3A
    see all
  • FunctionInvolved in exocytosis by regulating a late step in synaptic vesicle fusion. Could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal.
  • Tissue specificitySpecifically expressed in brain.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Rab family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human Rab3A protein images

  • 15% SDS-PAGE analysis of 3µg ab109964.

References for Recombinant Human Rab3A protein (ab109964)

ab109964 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109964.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"