Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO95716
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMASAGDTQAGPRDAADQNFDYMFKLLLIGN SSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAG QERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQV ILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLV DVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC
    • Molecular weight26 kDa including tags
    • Amino acids1 to 219
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109943 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab109943 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • D2-2
    • Glioblastoma overexpressed
    • GOV
    • RAB 16
    • RAB16
    • Rab3d
    • Rab3D upregulated with myeloid differentiation
    • RAB3D, member RAS oncogene family
    • RAB3D_HUMAN
    • RAD3D
    • Ras-related protein Rab-3D
    see all
  • FunctionProtein transport. Probably involved in regulated exocytosis.
  • Tissue specificityHighly expressed in granulocytes of peripheral blood. Constitutively expressed at low levels in all hematopoietic cell lines investigated.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Rab family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human Rab3D protein images

  • 15% SDS-PAGE analysis of 3µg ab109943.

References for Recombinant Human Rab3D protein (ab109943)

ab109943 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109943.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"