Recombinant Human RAB3IL1 protein (ab159295)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MWSGPPQPDQGLPPPLAAVPVPWKSTDPCQGHRESPGALVETSAGEEAQG QEGPAAAQLDVLRLRSSSMEIREKGSEFLKEELHRAQKELKLKDEECERL SKVREQLEQELEELTASLFEEAHKMVREANMKQAASEKQLKEARGKIDML QAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRHKSTSSTLC PAVCPAAGHTLTPDREGKEVDTILFAEFQAWRESPTLDKTCPFLERVYRE DVGPCLDFTMQELSVLVRAAVEDNTLTIEPVASQTLPTVKVAEVDCSSTN TCALSGLTRTCRHRIRLGDSKSHYYISPSSRARITAVCNFFTYIRYIQQG LVRQDAEPMFWEIMRLRKEMSLAKLGFFPQEA
    • Amino acids
      1 to 382
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159295 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GRAB
    • Guanine nucleotide exchange factor for Rab 3A
    • Guanine nucleotide exchange factor for Rab-3A
    • Guanine nucleotide exchange factor for Rab3A
    • R3GEF_HUMAN
    • Rab-3A-interacting-like protein 1
    • Rab3A interacting like protein 1
    • RAB3A interacting protein (rabin3) like 1
    • Rab3A-interacting-like protein 1
    • RAB3IL1
    • Rabin3 like 1
    • Rabin3-like 1
    see all
  • Function
    Guanine nucleotide exchange factor (GEF) which may activate RAB3A, a GTPase that regulates synaptic vesicle exocytosis. Promotes the exchange of GDP to GTP, converting inactive GDP-bound Rab proteins into their active GTP-bound form. May also activate RAB8A and RAB8B.
  • Sequence similarities
    Belongs to the SEC2 family.
  • Information by UniProt

Images

  • ab159295 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159295 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159295.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up