Recombinant Human RAB3IP protein (ab165127)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MANDPLEGFHEVNLASPTSPDLLGVYESGTQEQTTSPSVIYRPHPSALSS VPIQANALDVSELPTQPVYSSPRRLNCAEISSISFHVTDPAPCSTSGVTA GLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTDSLSRLRSPSV LEVREKGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTASL FEEAHKMVREANIKQATAEKQLKEAQGKIDVLQAEVAALKTLVLSSSPTS PTQEPLPGGKTPFKKGHTRNKSTSSAMSGSHQDLSVIQPIVKDCKEADLS LYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLTFSKSELASAVLEAVEN NTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKSCKHRIKLGDSSNY YYISPFCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLRKEMSL AKLGYFKEEL
    • Amino acids
      1 to 460
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165127 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Gtpat12
    • Rab-3A-interacting protein
    • RAB3A interacting protein
    • RAB3A interacting protein (rabin3)
    • RAB3A-interacting protein
    • RAB3I_HUMAN
    • Rab3ip
    • Rabin 3
    • Rabin-3
    • RABIN3
    • RABIN3, rat, homolog of
    • Rabin8
    • SSX2 interacting protein
    • SSX2-interacting protein
    see all
  • Function
    Guanine nucleotide exchange factor (GEF) which may activate RAB8A and RAB8B. Promotes the exchange of GDP to GTP, converting inactive GDP-bound Rab proteins into their active GTP-bound form. Mediates the release of GDP from RAB8A and RAB8B but not from RAB3A or RAB5. Modulates actin organization and promotes polarized transport of RAB8A-specific vesicles to the cell surface. Together with RAB11A, RAB8A, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis.
  • Tissue specificity
    Expressed in brain, kidney, heart, pancreas and placenta. Not detected in skeletal muscle or liver.
  • Sequence similarities
    Belongs to the SEC2 family.
  • Cellular localization
    Cytoplasm. Nucleus. Cytoplasm, cytoskeleton. Cell projection, lamellipodium. Predominantly cytoplasmic but a small proportion colocalizes with SSX2 in the nucleus. Activation of protein kinase C results in redistribution to the periphery of lamellipodia. In the cytoskeleton, localizes to cortical actin.
  • Information by UniProt

Images

  • ab165127 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165127 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165127.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up