Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP20338
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSQTAMSETYDFLFKFLVIGNAGTGKSCLL HQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTR SYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDL DADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIES GELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC
    • Molecular weight27 kDa including tags
    • Amino acids1 to 218
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab109957 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 20% Glycerol, 0.58% Sodium chloride, 0.32% Tris HCl, 0.02% DTT

General Info

  • Alternative names
    • HRES 1 / RAB4
    • Oncogene RAB4
    • Rab 4
    • RAB 4A
    • RAB4 member RAS oncogene family
    • Rab4a
    • RAB4A member RAS oncogene family
    • RAB4A_HUMAN
    • Ras related protein Rab 4A
    • Ras related protein Rab4A
    • Ras-related protein Rab-4A
    see all
  • FunctionProtein transport. Probably involved in vesicular traffic.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Rab family.
  • Post-translational
    modifications
    Phosphorylated by CDK1 kinase during mitosis.
  • Cellular localizationMembrane. Cytoplasm. Generally associated with membranes. Cytoplasmic when phosphorylated by CDK1.
  • Information by UniProt

Recombinant Human Rab4 protein images

  • 15% SDS-PAGE showing ab109957 at approximately 26.5 kDa (3µg).

References for Recombinant Human Rab4 protein (ab109957)

ab109957 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"