Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGPGPGPGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGST IGVDFTMKTLEIQGKRVKLQIWDTAGQERFRTITQSYYRSANGAILAYDI TKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLA EHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLN SKDIGEGWGCGC
    • Amino acids
      1 to 212
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab166258 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • RAB41
    • RAB43
    • RAB43_HUMAN
    • Ras related protein Rab 41
    • Ras related protein Rab 43
    • Ras-related protein Rab-41
    • Ras-related protein Rab-43
    see all
  • Tissue specificity
    Widely expressed in brain, testis, lung, heart, ovary, colon, kidney, uterus and spleen but not in liver.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab166258 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166258 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166258.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up