Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMTSRSTARPNGQPQASKICQFKLVLLG ESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTA GQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIV IALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAI AKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN
    • Molecular weight
      26 kDa including tags
    • Amino acids
      1 to 215
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104545 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab104545 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Rab 5b
    • Rab5 b
    • RAB5B, member RAS oncogene family
    • Ras related protein Rab 5B
    • RAS-associated protein RAB5B
    see all
  • Relevance
    Rab5b is a member of the Rab family of small (monomeric) G proteins. Like other small G proteins, Rab5b switches between an inactive, GDP-form and an active, GTP-bound form. GDP/GTP exchange factors (GEFs) catalyse the conversion from the GDP-bound form to the GTP-bound form, while GTPase-activating proteins (GAPs) catalyse GTP hydrolysis to GDP. Rab5b is involved in endocytosis and recycling of cell surface molecules. It interacts with RIN2 and RIN3, which regulate its function, possibly by acting as GEFs. Knockdown of Rab5b abolished group I metabotropic glutamate receptor (mGluR)-mediated neuroprotection. Furthermore, Rab5b interacts with LRRK2, the defective gene at the PARK8 locus that results in Parkinson's disease. Roles for Rab5b in neurodegenerative disease, neuroprotection, and synaptic plasticity have been suggested.
  • Cellular localization
    Cell Membrane, Endosome

Images

  • 15% SDS-PAGE analysis of 3µg ab104545.

References

ab104545 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104545.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up