Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAGRGGAARPNGPAAGNKICQFKLVLL GESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDT AGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNI VIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMA IAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
    • Molecular weight
      26 kDa including tags
    • Amino acids
      1 to 216
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156358 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab156358 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Additional notes

    The activity of this product has not been tested

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 30% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • L1880
    • RAB, member of RAS oncogene family like
    • RAB5C
    • RAB5C, member of RAS oncogene family
    • RAB5C, member RAS oncogene family
    • RAB5C_HUMAN
    • RAB5CL
    • RAB5L
    • RABL
    • Ras-related protein Rab-5C
    see all
  • Function
    Protein transport. Probably involved in vesicular traffic.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization
    Cell membrane. Early endosome membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab156358.

References

ab156358 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156358.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up