Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGRGGARRPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQ ESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVV YDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQ AYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGV DLQENNPASRSQCCSN
    • Amino acids
      1 to 216
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159299 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • L1880
    • RAB, member of RAS oncogene family like
    • RAB5C
    • RAB5C, member of RAS oncogene family
    • RAB5C, member RAS oncogene family
    • RAB5C_HUMAN
    • RAB5CL
    • RAB5L
    • RABL
    • Ras-related protein Rab-5C
    see all
  • Function
    Protein transport. Probably involved in vesicular traffic.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization
    Cell membrane. Early endosome membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • ab159299 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159299 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159299.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up