Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP20340
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMSTGGDFGNPLRKFKLVFLGEQSVGK TSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFR SLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGN KTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPG MESTQDRSREDMIDIKLEKPQEQPVSEGGCSC
    • Molecular weight26 kDa including tags
    • Amino acids1 to 208
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101642 was purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: 0% None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • GTP binding protein RAB6A'
    • GTP binding protein RAB6B
    • Oncogene RAB6
    • Rab 6
    • Rab GTPase
    • Rab-6
    • RAB6
    • RAB6 member RAS oncogene family
    • RAB6A
    • RAB6A member RAS oncogene family
    • Rab6A variant 3
    • RAB6A'
    • RAB6A_HUMAN
    • RAB6B
    • Ras related protein Rab 6A
    • Ras-related protein Rab-6A
    • RCO4 3
    see all
  • FunctionProtein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER). Has a low GTPase activity.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Rab family.
  • Cellular localizationGolgi apparatus membrane.
  • Information by UniProt

Recombinant Human RAB6A protein images

  • ab101642 at 3 µg analysed by 15% SDS PAGE.

References for Recombinant Human RAB6A protein (ab101642)

ab101642 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"