Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMSTGGDFGNPLRKFKLVFLGEQSVGK TSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFR SLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGN KTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPG MESTQDRSREDMIDIKLEKPQEQPVSEGGCSC
    • Molecular weight
      26 kDa including tags
    • Amino acids
      1 to 208
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab101642 was purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: 0% None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • GTP binding protein RAB6A'
    • GTP binding protein RAB6B
    • Oncogene RAB6
    • Rab 6
    • Rab GTPase
    • Rab-6
    • RAB6
    • RAB6 member RAS oncogene family
    • RAB6A
    • RAB6A member RAS oncogene family
    • Rab6A variant 3
    • RAB6A'
    • RAB6A_HUMAN
    • RAB6B
    • Ras related protein Rab 6A
    • Ras-related protein Rab-6A
    • RCO4 3
    see all
  • Function
    Protein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER). Has a low GTPase activity.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab101642 at 3 µg analysed by 15% SDS PAGE.

References

ab101642 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up