Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP61006
    • SpeciesHuman
    • SequenceMAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTI ELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIR NWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMET SAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSS FFRCVLL
    • Molecular weight49 kDa including tags
    • Amino acids1 to 207

Specifications

Our Abpromise guarantee covers the use of ab116785 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AA409338
    • MEL
    • Mel transforming oncogene
    • Mel transforming oncogene (derived from cell line NK14)
    • Mel transforming oncogene (derived from cell line NK14) RAB8 homolog
    • Mel transforming oncogene (RAB8 homolog)
    • MGC124948
    • Oncogene c mel
    • Oncogene c-mel
    • RAB8
    • RAB8A
    • RAB8A member RAS oncogene family
    • RAB8A_HUMAN
    • Ras associated protein RAB8
    • Ras related protein Rab 8A
    • Ras-related protein Rab-8A
    see all
  • FunctionMay be involved in vesicular trafficking and neurotransmitter release. Together with RAB11A, RAB3IP, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B and RAB11A participates in epithelial cell polarization.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Rab family.
  • Cellular localizationCell membrane. Golgi apparatus. Cytoplasm > perinuclear region. Cell projection. Colocalizes with OPTN at the Golgi complex and in vesicular structures close to the plasma membrane. In the GDP-bound form, present in the perinuclear region. Shows a polarized distribution to distal regions of cell protrusions in the GTP-bound form. Colocalizes with PARD3, PRKCI, EXOC5, OCLN, PODXL and RAB11A in apical membrane initiation sites (AMIS) during the generation of apical surface and luminogenesis.
  • Information by UniProt

Recombinant Human RAB8A protein images

  • ab116785 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human RAB8A protein (ab116785)

ab116785 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116785.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"