Recombinant Human RABEP1 protein (ab160352)

Overview

  • Product name
    Recombinant Human RABEP1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KSQQLESLQEIKISLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVS EQVQRDFVKLSQTLQVQLERIRQADSLERIRAILNDTKLTDINQLPET
    • Amino acids
      765 to 862
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160352 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Neurocrescin
    • Rab GTPase binding effector protein 1
    • RAB5EP
    • Rabaptin 4
    • Rabaptin 5
    • Rabaptin 5alpha
    • RABPT5
    • RABPT5A
    • Renal carcinoma antigen NY REN 17
    • Renal carcinoma antigen NYREN17
    see all
  • Relevance
    RABEP1 is a Rab effector protein acting as linker between gamma-adaptin, RAB4A and RAB5A. It is involved in endocytic membrane fusion and membrane trafficking of recycling endosomes. Stimulates RABGEF1 mediated nucleotide exchange on RAB5A.
  • Cellular localization
    Cytoplasm. Early endosome. Recycling endosome

Images

  • ab160352 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160352 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160352.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up