Recombinant Human RABGGTA protein (ab116789)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ92696
    • SpeciesHuman
    • SequenceMHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLE LTSQILGANPDFATLWNCRREVLQQLETQKSPEELAALVKAELGFLESCL RVNPKSYGTWHHRCWLLGRLPEPNWTRELELCARFLEVDERNFHCWDYRR FVATQAAVPPAEELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQ GRLPEDVLLKELELVQNAFFTDPNDQSAWFYHRWLLGRADPQDALRCLHV SRDEACLTVSFSRPLLVGSRMEILLLMVDDSPLIVEWRTPDGRNRPSHVW LCDLPAASLNDQLPQHTFRVIWTAGDVQKECVLLKGRQEGWCRDSTTDEQ LFRCELSVEKSTVLQSELESCKELQELEPENKWCLLTIILLMRALDPLLY EKETLQYFQTLKAVDPMRATYLDDLRSKFLLENSVLKMEYAEVRVLHLAH KDLTVLCHLEQLLLVTHLDLSHNRLRTLPPALAALRCLEVLQASDNAIES LDGVTNLPRLQELLLCNNRLQQPAVLQPLASCPRLVLLNLQGNPLCQAVG ILEQLAELLPSVSSVLT
    • Molecular weight88 kDa including tags
    • Amino acids1 to 567

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISpot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Geranylgeranyl transferase type 2 subunit alpha
    • Geranylgeranyl transferase type II subunit alpha
    • Geranylgeranyl transferase type-2 subunit alpha
    • PGTA_HUMAN
    • Protein prenyltransferase alpha subunit repeat containing 3
    • PTAR3
    • Rab geranyl geranyltransferase subunit alpha
    • Rab geranyl-geranyltransferase subunit alpha
    • Rab geranylgeranyltransferase alpha subunit
    • Rab geranylgeranyltransferase subunit alpha
    • Rab GG transferase alpha
    • Rab GGTase alpha
    • RABGGTA
    see all
  • FunctionCatalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.
  • Sequence similaritiesBelongs to the protein prenyltransferase subunit alpha family.
    Contains 5 LRR (leucine-rich) repeats.
    Contains 6 PFTA repeats.
  • Information by UniProt

Recombinant Human RABGGTA protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human RABGGTA protein (ab116789)

ab116789 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"