Overview

  • Product name
    Recombinant Human RABL4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVP VPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDVTNEESFNNC SKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECF ETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA
    • Amino acids
      1 to 186
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161248 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BBS19
    • Ift27
    • IFT27_HUMAN
    • Intraflagellar transport 27
    • Intraflagellar transport protein 27 homolog
    • Putative GTP binding protein RAY like
    • Putative GTP-binding protein RAY-like
    • Rab like protein 4
    • RAB member of RAS oncogene family like 4
    • Rab-like protein 4
    • RAYL
    see all
  • Function
    Small GTPase-like component of the intraflagellar transport (IFT) complex B that promotes the exit of the BBSome complex from cilia via its interaction with ARL6 (PubMed:25443296). Not involved in entry of the BBSome complex into cilium. Prevents aggregation of GTP-free ARL6 (PubMed:25443296). Required for hedgehog signaling. Forms a subcomplex within the IFT complex B with IFT25.
  • Involvement in disease
    Bardet-Biedl syndrome 19
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization
    Cell projection, cilium.
  • Information by UniProt

Images

  • ab161248 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161248 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161248.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up