Recombinant Human Rac1 protein (ab51014)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKP VNLGLWDTA GQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWY PEVRHHCPNTPIILVGTKLDL RDDKDTIEKLKEKKLTPITYPQGLAMA KEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL

Specifications

Our Abpromise guarantee covers the use of ab51014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Purity> 95 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 20mM Tris HCl, 2mM EDTA, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • Cell migration inducing gene 5 protein
    • Cell migration-inducing gene 5 protein
    • MGC111543
    • MIG5
    • Migration inducing gene 5
    • Migration inducing protein 5
    • p21 Rac1
    • p21-Rac1
    • Rac 1
    • RAC1
    • RAC1_HUMAN
    • Ras like protein TC25
    • Ras related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
    • Ras-like protein TC25
    • Ras-related C3 botulinum toxin substrate 1
    • Rho family small GTP binding protein Rac1
    • TC 25
    • TC25
    see all
  • FunctionPlasma membrane-associated small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate cellular responses such as secretory processes, phagocytosis of apoptotic cells, epithelial cell polarization and growth-factor induced formation of membrane ruffles. Rac1 p21/rho GDI heterodimer is the active component of the cytosolic factor sigma 1, which is involved in stimulation of the NADPH oxidase activity in macrophages (By similarity). Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly.
    Isoform B has an accelerated GEF-independent GDP/GTP exchange and an impaired GTP hydrolysis, which is restored partially by GTPase-activating proteins. It is able to bind to the GTPase-binding domain of PAK but not full-length PAK in a GTP-dependent manner, suggesting that the insertion does not completely abolish effector interaction.
  • Tissue specificityIsoform B is predominantly identified in skin and epithelial tissues from the intestinal tract. Its expression is elevated in colorectal tumors at various stages of neoplastic progression, as compared to their respective adjacent tissues.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Rho family.
  • DomainThe effector region mediates interaction with DEF6.
  • Post-translational
    modifications
    AMPylation at Tyr-32 and Thr-35 are mediated by bacterial enzymes in case of infection by H.somnus and V.parahaemolyticus, respectively. AMPylation occurs in the effector region and leads to inactivation of the GTPase activity by preventing the interaction with downstream effectors, thereby inhibiting actin assembly in infected cells. It is unclear whether some human enzyme mediates AMPylation; FICD has such ability in vitro but additional experiments remain to be done to confirm results in vivo.
  • Cellular localizationCell membrane. Melanosome. Inner surface of plasma membrane possibly with attachment requiring prenylation of the C-terminal cysteine (By similarity). Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Recombinant Human Rac1 protein images

  • ab51014 in 15% SDS PAGE

References for Recombinant Human Rac1 protein (ab51014)

ab51014 has not yet been referenced specifically in any publications.

Product Wall

Abreviews
Application Functional Studies
This product is good for functional assays.

I step up an assay using RAC1 and Bodipy-GDP, a fluorescent analog of GDP. The fluorescence of Bodipy-GDP is quenched in solution and increases upon binding to RAC1. The nucleotide exchange capacity of RAC1 was then tested by adding TIAM1, a guanine exchange factor with selectivity for RAC1. Fluorescence intensity (FI) was recorded for 25 min.
Addition of buffer (vehicle) to the mixture of RAC1 and Bodipy-GDP resulted in the expected slow increase in FI due to RAC1 own's ability to exchange GDP. Whereas addition of TIAM resulted in a far quicker increase in FI.
Both results indicate the functionality of RAC1 in this assay.
Username

Abcam user community

Verified customer

Submitted Oct 03 2016

Vielen Dank für Ihre Anfrage. Gegen die genannten NADPH-Oxidase-Komponenten haben wir folgende Antikörper bzw. Proteine in unserem Katalog: Click here (or use the following: http://www.abcam.com/index.html?datasheet=109366). Click here (or use the...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"