Recombinant Human RAC3 protein (ab103470)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Suitable for: SDS-PAGE, MS
Description
-
Product name
Recombinant Human RAC3 protein
See all RAC3 proteins and peptides -
Purity
> 95 % SDS-PAGE.
ab103470 was purified using conventional chromatography techniques. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKP VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPE VRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIG SVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKC -
Predicted molecular weight
21 kDa -
Amino acids
1 to 189
-
Specifications
Our Abpromise guarantee covers the use of ab103470 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.00174% PMSF, 0.0308% DTT, 0.316% Tris HCl, 0.0292% EDTA, 10% Glycerol (glycerin, glycerine), 1.16% Sodium chloride
General Info
-
Alternative names
- OTTMUSP00000004488
- p21 Rac3
- p21-Rac3
see all -
Function
Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as cell spreading and the formation of actin-based protusions including lamellipodia and membrane ruffles. Promotes cell adhesion and spreading on fibrinogen in a CIB1 and alpha-IIb/beta3 integrin-mediated manner. -
Tissue specificity
Highest levels in brain, also detected in heart, placenta and pancreas. -
Sequence similarities
Belongs to the small GTPase superfamily. Rho family. -
Post-translational
modifications(Microbial infection) Glycosylated at Tyr-32 by Photorhabdus asymbiotica toxin PAU_02230. Mono-O-GlcNAcylation by PAU_02230 inhibits downstream signaling by an impaired interaction with diverse regulator and effector proteins of Rac and leads to actin disassembly. -
Cellular localization
Cytoplasm. Endomembrane system. Cell projection, lamellipodium. Cytoplasm, perinuclear region. Cell membrane. Cytoplasm, cytoskeleton. Membrane-associated when activated. Colocalizes with NRBP to endomembranes and at the cell periphery in lamellipodia. Colocalized with CIB1 in the perinuclear area and at the cell periphery. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab103470 has not yet been referenced specifically in any publications.