Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKP VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPE VRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIG SVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKC
    • Molecular weight
      21 kDa
    • Amino acids
      1 to 189

Specifications

Our Abpromise guarantee covers the use of ab103470 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab103470 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 200mM Sodium chloride, 20mM Tris HCl, 2mM DTT, 1mM EDTA, 0.1mM PMSF, pH 8.0

General Info

  • Alternative names
    • OTTMUSP00000004488
    • p21 Rac3
    • p21-Rac3
    • Rac1B
    • RAC3
    • RAC3_HUMAN
    • RAS related C3 botulinum substrate 3
    • Ras related C3 botulinum toxin substrate 3 (rho family small GTP binding protein Rac3)
    • Ras related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)
    • Ras-related C3 botulinum toxin substrate 3
    • Rho family small GTP binding protein Rac3
    • RP23-84C12.18
    see all
  • Function
    Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as cell spreading and the formation of actin-based protusions including lamellipodia and membrane ruffles. Promotes cell adhesion and spreading on fibrinogen in a CIB1 and alpha-IIb/beta3 integrin-mediated manner.
  • Tissue specificity
    Highest levels in brain, also detected in heart, placenta and pancreas.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rho family.
  • Post-translational
    modifications
    (Microbial infection) Glycosylated at Tyr-32 by Photorhabdus asymbiotica toxin PAU_02230. Mono-O-GlcNAcylation by PAU_02230 inhibits downstream signaling by an impaired interaction with diverse regulator and effector proteins of Rac and leads to actin disassembly.
  • Cellular localization
    Cytoplasm. Endomembrane system. Cell projection, lamellipodium. Cytoplasm, perinuclear region. Cell membrane. Cytoplasm, cytoskeleton. Membrane-associated when activated. Colocalizes with NRBP to endomembranes and at the cell periphery in lamellipodia. Colocalized with CIB1 in the perinuclear area and at the cell periphery.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab103470.

References

ab103470 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103470.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up