Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF PARKRGNLSSLEQIYGLENSKEYLSENEPWVDKYKPETQHELAVHKKKIE EVETWLKAQV
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159302 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCYC
    • Cell cycle checkpoint protein
    • Cell cycle checkpoint protein RAD17
    • FLJ41520
    • HRAD 17
    • hRad17
    • R24L
    • Rad 17
    • Rad 24
    • RAD1 (S. pombe) homolog
    • RAD1 homolog
    • RAD17
    • RAD17 homolog
    • RAD17 homolog (S. pombe)
    • Rad17 like protein
    • RAD17, S. pombe, homolog of
    • RAD17_HUMAN
    • RAD17Sp
    • Rad24
    • Rad24, mouse, homolog of
    • Rad24, S. cerevisiae, homolog of
    • RF C activator 1 homolog
    • RF C/activator 1 homolog
    • RF-C/activator 1 homolog
    see all
  • Function
    Essential for sustained cell growth, maintenance of chromosomal stability, and ATR-dependent checkpoint activation upon DNA damage. Has a weak ATPase activity required for binding to chromatin. Participates in the recruitment of the RAD1-RAD9-HUS1 complex onto chromatin, and in CHEK1 activation. May also serve as a sensor of DNA replication progression, and may be involved in homologous recombination.
  • Tissue specificity
    Overexpressed in various cancer cell lines and in colon carcinoma (at protein level). Isoform 2 and isoform 3 are the most abundant isoforms in non irradiated cells (at protein level). Ubiquitous at low levels. Highly expressed in testis, where it is expressed within the germinal epithelium of the seminiferous tubuli. Weakly expressed in seminomas (testicular tumors).
  • Sequence similarities
    Belongs to the rad17/RAD24 family.
  • Post-translational
    modifications
    Phosphorylated. Phosphorylation on Ser-646 and Ser-656 is cell cycle-regulated, enhanced by genotoxic stress, and required for activation of checkpoint signaling. Phosphorylation is mediated by ATR upon UV or replication arrest, whereas it may be mediated both by ATR and ATM upon ionizing radiation. Phosphorylation on both sites is required for interaction with RAD1 but dispensable for interaction with RFC3 or RFC4.
  • Cellular localization
    Nucleus. Phosphorylated form redistributes to discrete nuclear foci upon DNA damage.
  • Information by UniProt

Images

  • ab159302 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159302 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159302.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up