Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVK MALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEEN REAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFSLNQSRVEEITMREEVG NISILQENDFGDFGMDDREIMREGSAFEDDDMLVSTTTSNLLLESEQSTS NLNEKINHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGGIFDDPPALSE AGVMLPEQPAHDDMDEDDNVSMGGPDSPDSVDPVEPMPTMTDQTTLVPNE EEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTT LDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPED LRKRRKGGEADNLDEFLKEFENPEVPREDQQQQHQQRDVIDEPIIEEPSR LQESVMEASRTNIDESAMPPPPPQGVKRKAGQIDPEPVMPPQQVEQMEIP PVELPPEEPPNICQLIPELELLPEKEKEKEKEKEDDEEEEDEDASGGDQD QEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSF LVLKKQQAIELTQEEPYSDIIATPGPRFHII
    • Molecular weight
      98 kDa including tags
    • Amino acids
      1 to 631
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDLS4
    • Double-strand-break repair protein rad21 homolog
    • hHR21
    • HR21
    • HRAD21
    • KIAA0078
    • MCD1
    • Nuclear matrix protein 1
    • NXP-1
    • NXP1
    • Protein involved in DNA double-strand break repair
    • RAD21
    • RAD21 homolog
    • RAD21 homolog (S. pombe)
    • RAD21_HUMAN
    • Scc1
    • SCC1 homolog
    see all
  • Function
    Cleavable component of the cohesin complex, involved in chromosome cohesion during cell cycle, in DNA repair, and in apoptosis. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At metaphase-anaphase transition, this protein is cleaved by separase/ESPL1 and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis. Also plays a role in apoptosis, via its cleavage by caspase-3/CASP3 or caspase-7/CASP7 during early steps of apoptosis: the C-terminal 64 kDa cleavage product may act as a nuclear signal to initiate cytoplasmic events involved in the apoptotic pathway.
  • Sequence similarities
    Belongs to the rad21 family.
  • Domain
    The C-terminal part associates with the head of SMC1A, while the N-terminal part binds to the head of SMC3.
  • Post-translational
    modifications
    Cleaved by separase/ESPL1 at the onset of anaphase. Cleaved by caspase-3 and caspase-7 at the beginning of apoptosis. The cleavage by ESPL1 and caspase-3 take place at different sites.
    Phosphorylated; becomes hyperphosphorylated in M phase of cell cycle. The large dissociation of cohesin from chromosome arms during prophase may be partly due to its phosphorylation by PLK.
  • Cellular localization
    Nucleus. Chromosome. Chromosome > centromere. Associates with chromatin. Before prophase it is scattered along chromosome arms. During prophase, most of cohesin complexes dissociate from chromatin probably because of phosphorylation by PLK, except at centromeres, where cohesin complexes remain. At anaphase, it is cleaved by separase/ESPL1, leading to the dissociation of the complex from chromosomes, allowing chromosome separation. Once cleaved by caspase-3, the C-terminal 64 kDa cleavage product translocates to the cytoplasm, where it may trigger apoptosis.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152647 stained with Coomassie Blue.

References

ab152647 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up