Recombinant Human Rad51D protein (ab159305)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKAL VALRRVLLAQFSAFPVNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTG EVTEIVGGPGSGKTQVCLCMAANVAHGLQQNVLYVDSNGGLTASRLLQLL QAKTQDEEEQAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVTGSSGTV KVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNH ITRDRDSGRLKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSR QPTGFQEMVDIGTWGTSEQSATLQGDQT
    • Amino acids
      1 to 328
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159305 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BROVCA4
    • DNA repair protein RAD51 homolog 4
    • HsTRAD
    • OTTHUMP00000163851
    • OTTHUMP00000163852
    • OTTHUMP00000163853
    • R51H3
    • RA51D_HUMAN
    • RAD51 homolog D
    • RAD51 homolog D (S. cerevisiae)
    • RAD51 like 3 (S. cerevisiae)
    • RAD51 paralog D
    • RAD51, S. cerevisiae, homolog of, D
    • RAD51-like protein 3
    • Rad51l3
    • Recombination repair protein
    • S. cerevisiae RAD51-like 3
    • TRAD
    see all
  • Function
    Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. The BCDX2 complex binds single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA.
  • Tissue specificity
    Expressed in colon, prostate, spleen, testis, ovary, thymus and small intestine. Weakly expressed in leukocytes.
  • Sequence similarities
    Belongs to the RecA family. RAD51 subfamily.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159305 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159305 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159305.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up