Recombinant Human Rad51D protein (denatured) (ab177628)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHH SSGLVPRGSH MGSMGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSY KAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVTGSSGTVKVVVVDSVT AVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHITRDRDSGR LKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSRQPTGFQEMV DIGTWGTSEQSATLQGDQT
    • Molecular weight
      26 kDa including tags
    • Amino acids
      1 to 216
    • Tags
      His tag N-Terminus
    • Additional sequence information
      Isoform 3 (NP_598332)

Specifications

Our Abpromise guarantee covers the use of ab177628 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab177628 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • BROVCA4
    • DNA repair protein RAD51 homolog 4
    • HsTRAD
    • OTTHUMP00000163851
    • OTTHUMP00000163852
    • OTTHUMP00000163853
    • R51H3
    • RA51D_HUMAN
    • RAD51 homolog D
    • RAD51 homolog D (S. cerevisiae)
    • RAD51 like 3 (S. cerevisiae)
    • RAD51 paralog D
    • RAD51, S. cerevisiae, homolog of, D
    • RAD51-like protein 3
    • Rad51l3
    • Recombination repair protein
    • S. cerevisiae RAD51-like 3
    • TRAD
    see all
  • Function
    Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. The BCDX2 complex binds single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA.
  • Tissue specificity
    Expressed in colon, prostate, spleen, testis, ovary, thymus and small intestine. Weakly expressed in leukocytes.
  • Sequence similarities
    Belongs to the RecA family. RAD51 subfamily.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab177628 (3 µg).

References

ab177628 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177628.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up