Overview

  • Product name
    Recombinant Human RAD54 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KKALSSCVVDEEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNS RQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQ RSHEEQRGLR
    • Molecular weight
      38 kDa including tags
    • Amino acids
      638 to 747

Specifications

Our Abpromise guarantee covers the use of ab152868 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DNA repair and recombination protein RAD54 like
    • DNA repair and recombination protein RAD54-like
    • hHR 54
    • hHR54
    • HR 54
    • HR54
    • hRAD 54
    • hRAD54
    • RAD 54A
    • RAD 54L
    • RAD54 (S. cerevisiae) like
    • RAD54 homolog
    • RAD54 like
    • RAD54 like (S. cerevisiae)
    • RAD54 like protein
    • RAD54_HUMAN
    • RAD54A
    • RAD54L
    see all
  • Function
    Involved in DNA repair and mitotic recombination. Functions in the recombinational DNA repair (RAD52) pathway. Dissociates RAD51 from nucleoprotein filaments formed on dsDNA. Could be involved in the turnover of RAD51 protein-dsDNA filaments (By similarity). May play also an essential role in telomere length maintenance and telomere capping in mammalian cells.
  • Sequence similarities
    Belongs to the SNF2/RAD54 helicase family.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152868 stained with Coomassie Blue.

References

ab152868 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152868.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up