Recombinant Human Radixin protein (ab114380)

Overview

  • Product name
    Recombinant Human Radixin protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYV DSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQR LFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLAND RLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEM YGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISF NDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI EVQQMKAQAREEKHQKQLERAQLENEKEKREIAEKEKERIEREKEELMER LKQIEEQTIKAQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAK SAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAF AAQEDLEKTKEELKTVMSAPPPPPPPPVIPPTENEHDEHDENNAEASAEL SNEGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARDETKKTQNDVL HAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAM
    • Molecular weight
      90 kDa including tags
    • Amino acids
      1 to 583

Specifications

Our Abpromise guarantee covers the use of ab114380 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114380 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CB567
    • CG12537
    • DFNB24
    • ESP10
    • Hh-induced MATH and BTB domain-containing protein
    • HIB
    • Moesin-B
    • Protein roadkill
    • RADI_HUMAN
    • Radixin
    • RDX
    see all
  • Function
    Probably plays a crucial role in the binding of the barbed end of actin filaments to the plasma membrane.
  • Involvement in disease
    Defects in RDX are the cause of deafness autosomal recessive type 24 (DFNB24) [MIM:611022]. DFNB24 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
  • Sequence similarities
    Contains 1 FERM domain.
  • Domain
    The N-terminal domain interacts with the C-terminal domain of LAYN. An interdomain interaction between its N-terminal and C-terminal domains inhibits its ablilty to bind LAYN. In the presence of acidic phospholipids, the interdomain interaction is inhibited and this enhances binding to LAYN.
  • Post-translational
    modifications
    Phosphorylated by tyrosine-protein kinases.
  • Cellular localization
    Cell membrane. Cytoplasm > cytoskeleton. Cleavage furrow. Highly concentrated in the undercoat of the cell-to-cell adherens junction and the cleavage furrow in the interphase and mitotic phase, respectively.
  • Information by UniProt

Images

  • ab114380 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114380 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114380.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up