Recombinant Human RAG1AP1 protein (ab163292)

Overview

  • Product name
    Recombinant Human RAG1AP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTT EVNNLGWLSYGALKGDGILIVVNTVGAALQTLYILAYLHYCPRKAKVIQT KSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFPGIVTSFIRFWL FWKYPQEQDRNYWLLQT
    • Amino acids
      1 to 167
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163292 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HsSWEET1
    • Probable sugar transporter RAG1AP1
    • RAG1 activating protein 1
    • RAG1-activating protein 1
    • RAG1AP1
    • Recombination activating gene 1 activating protein 1
    • RP11-540D14.5
    • RZPDo834D038D
    • SCP
    • SLC50A1
    • slv
    • Solute carrier family 50 (sugar efflux transporter) member 1
    • Solute carrier family 50 (sugar transporter) member 1
    • Solute carrier family 50 member 1
    • Stromal cell protein
    • Sugar transporter SWEET1
    • SWEET1
    • SWET1_HUMAN
    see all
  • Function
    Mediates sugar transport across membranes. May stimulate V(D)J recombination by the activation of RAG1.
  • Tissue specificity
    Ubiquitously expressed with highest expression in oviduct, epididymis and intestine.
  • Sequence similarities
    Belongs to the SWEET sugar transporter family.
    Contains 2 MtN3/slv domains.
  • Cellular localization
    Golgi apparatus membrane. Cell membrane. May also localize to the endoplasmic reticulum.
  • Information by UniProt

Images

  • ab163292 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163292 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163292.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up