Recombinant human RAGE protein (Fc Chimera Active) (ab219875)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 60% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human RAGE protein (Fc Chimera Active)
See all RAGE proteins and peptides -
Biological activity
Immobilized ab219875 at 20 μg/mL (100 μL/well) can bind Human HMGB1, His Tag with a linear range of 0.313-5 μg/mL.
-
Purity
> 60 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPW DSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPG KPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVS VKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRT APIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWM KDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIE PGEEGPTAGSVGGSGLGTLALA -
Predicted molecular weight
61 kDa -
Amino acids
23 to 344 -
Additional sequence information
Extracellular domain with a human IgG1 Fc tag at the C-terminus.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab219875 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.4
Constituents: 0.75% Glycine, 5% Trehalose, 0.61% TrisThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 200 µg/ml.
General Info
-
Alternative names
- Advanced glycosylation end product-specific receptor
- Ager
- DAMA 358M23.4
see all -
Function
Mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. Acts as a mediator of both acute and chronic vascular inflammation in conditions such as atherosclerosis and in particular as a complication of diabetes. AGE/RAGE signaling plays an important role in regulating the production/expression of TNF-alpha, oxidative stress, and endothelial dysfunction in type 2 diabetes. Interaction with S100A12 on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key proinflammatory mediators. Interaction with S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (By similarity). Receptor for amyloid beta peptide. Contributes to the translocation of amyloid-beta peptide (ABPP) across the cell membrane from the extracellular to the intracellular space in cortical neurons. ABPP-initiated RAGE signaling, especially stimulation of p38 mitogen-activated protein kinase (MAPK), has the capacity to drive a transport system delivering ABPP as a complex with RAGE to the intraneuronal space. -
Tissue specificity
Endothelial cells. -
Sequence similarities
Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
Images
-
ab219875 on SDS-PAGE under reducing (R) conditions. The gel was stained overnight with Coomassie Blue. The protein migrates as 80-90 kDa and 35 kDa Fc fragment under reducing (R) conditions due to glycosylation and auto-cleavage.
-
Immobilized ab219875 at 20 μg/mL (100 μL/well) can bind Human HMGB1, His Tag with a linear range of 0.313-5 μg/mL.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab219875 has not yet been referenced specifically in any publications.