Recombinant Human RAGEF2 protein (ab162655)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LFPVVKKDMTFLHEGNDSKVDGLVNFEKLRMISKEIRQVVRMTSANMDPA MMFRQRSLSQGSTNSNMLDVQGGAHKKRARRSSLLNAKKLYEDAQMARK
    • Amino acids
      1012 to 1110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162655 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp667N084
    • DKFZp686I15116
    • KIA001LB
    • PDZ domain containing guanine nucleotide exchange factor (GEF) 2
    • PDZ domain containing guanine nucleotide exchange factor 2
    • PDZ domain containing guanine nucleotide exchange factor I
    • PDZ domain-containing guanine nucleotide exchange factor 2
    • PDZ GEF 2
    • PDZ GEF2
    • PDZ-GEF2
    • PDZGEF 2
    • PDZGEF2
    • RA GEF 2
    • RA GEF2
    • RA-GEF-2
    • RAGEF 2
    • Rap guanine nucleotide exchange factor (GEF) 6
    • Rap guanine nucleotide exchange factor 2
    • Rap guanine nucleotide exchange factor 6
    • RAPGEF6
    • RPGF6_HUMAN
    see all
  • Function
    Guanine nucleotide exchange factor (GEF) for Rap1A, Rap2A and M-Ras GTPases. Does not interact with cAMP.
  • Tissue specificity
    Isoform 3 has highest expression levels in the brain, heart, liver, lung and placenta and is barely detectable in skeletal muscle, kidney and pancreas.
  • Sequence similarities
    Contains 1 cyclic nucleotide-binding domain.
    Contains 1 N-terminal Ras-GEF domain.
    Contains 1 PDZ (DHR) domain.
    Contains 1 Ras-associating domain.
    Contains 1 Ras-GEF domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm. Cell membrane. Upon binding to M-Ras, it translocates to the plasma membrane.
  • Information by UniProt

Images

  • ab162655 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162655 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162655.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up