Overview

  • Product name
    Recombinant Human RAI3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLP ILVCKVQDSNRRKMLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFL FGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVGFSLVQDVIAI EYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFC GSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALA ANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAY SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY EVKKEGS
    • Amino acids
      1 to 357
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160313 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G protein coupled receptor family C group 5 member A
    • G-protein coupled receptor family C group 5 member A
    • GPCR 5A
    • GPCR5A
    • Gprc 5a
    • Gprc5a
    • Orphan G protein coupling receptor PEIG 1
    • Orphan G protein coupling receptor PEIG1
    • Orphan G-protein-coupling receptor PEIG-1
    • RAI 3
    • RAI3_HUMAN
    • Raig 1
    • RAIG-1
    • Raig1
    • Retinoic acid induced 3
    • Retinoic acid induced gene 1 protein
    • Retinoic acid induced protein 3
    • Retinoic acid responsive
    • Retinoic acid responsive gene
    • Retinoic acid-induced gene 1 protein
    • Retinoic acid-induced protein 3
    see all
  • Function
    Unknown. This G-protein coupled receptor could be involved in modulating differentiation and maintaining homeostasis of epithelial cells. The comparable expression level in fetal lung and kidney with adult tissues suggests a possible role in embryonic development and maturation of these organs. This retinoic acid-inducible GPCR provide evidence for a possible interaction between retinoid and G-protein signaling pathways.
  • Tissue specificity
    Expressed at high level in fetal and adult lung tissues. Constitutively expressed in fetal kidney and adult placenta, kidney, prostate, testis, ovary, small intestine, colon, stomach, and spinal chord at low to moderate levels. Not detectable in fetal heart, brain, and liver and adult heart, brain, liver, skeletal muscle, pancreas, spleen, thymus, and peripheral leukocytes. According to PubMed:10783259, expressed at low but detectable level in pancreas and heart.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 3 family.
  • Cellular localization
    Cell membrane. Cytoplasmic vesicle membrane. Localized in the plasma membrane and perinuclear vesicles.
  • Information by UniProt

Images

  • ab160313 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160313 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160313.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up