Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GSHMEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQ TTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDL PAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYR CKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPS LLLHMLE
    • Molecular weight
      23 kDa
    • Amino acids
      1 to 199

Specifications

Our Abpromise guarantee covers the use of ab172821 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

General Info

  • Alternative names
    • CASP2 and RIPK1 domain containing adaptor with death domain
    • Caspase and RIP adapter with death domain
    • Caspase and RIP adaptor with death domain
    • Cradd
    • CRADD_HUMAN
    • Death adaptor molecule RAIDD
    • Death domain containing protein CRADD
    • Death domain-containing protein CRADD
    • MGC9163
    • RIP associated ICH1/CED3 homologous protein with death domain
    • RIP associated protein with a death domain
    • RIP-associated protein with a death domain
    see all
  • Function
    Apoptotic adaptor molecule specific for caspase-2 and FASL/TNF receptor-interacting protein RIP. In the presence of RIP and TRADD, CRADD recruits caspase-2 to the TNFR-1 signalling complex.
  • Tissue specificity
    Constitutively expressed in most tissues, with particularly high expression in adult heart, testis, liver, skeletal muscle, fetal liver and kidney.
  • Sequence similarities
    Contains 1 CARD domain.
    Contains 1 death domain.
  • Domain
    Contains a death domain involved in the binding of RIP protein.
    The CARD domain mediates the interaction with caspase-2.
  • Information by UniProt

References

ab172821 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172821.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up