Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP11234
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMAANKSKGQSSLALHKVIMVGSGGVG KSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYA AIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVV GNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREI RTKKMSENKDKNGKKSSKNKKSFKERC
    • Molecular weight26 kDa including tags
    • Amino acids1 to 203
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102696 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab102696 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 5730472O18Rik
    • dRalb
    • GTP binding protein
    • Ralb
    • RALB_HUMAN
    • RAS like protein B
    • Ras related GTP binding protein B
    • Ras-related protein Ral-B
    • V ral simian leukemia viral oncogene homolog B
    • v ral simian leukemia viral oncogene homolog B (ras related GTP binding protein)
    • v ral simian leukemia viral oncogene homolog B (ras related)
    see all
  • FunctionMultifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. Required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells. Plays a role in the late stages of cytokinesis and is required for the abscission of the bridge joining the sister cells emerging from mitosis. Required for suppression of apoptosis.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Ras family.
  • Post-translational
    modifications
    Prenylation is essential for membrane localization. The geranylgeranylated form and the farnesylated mutant does not undergo alternative prenylation in response to geranylgeranyltransferase I inhibitors (GGTIs) and farnesyltransferase I inhibitors (FTIs).
  • Cellular localizationCell membrane. During late cytokinesis localizes at the midbody.
  • Information by UniProt

Recombinant Human RALB protein images

  • 15% SDS-PAGE analysis of 3µg ab102696.

References for Recombinant Human RALB protein (ab102696)

ab102696 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102696.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"