Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMAANKSKGQSSLALHKVIMVGSGGVG KSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYA AIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVV GNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREI RTKKMSENKDKNGKKSSKNKKSFKERC
    • Molecular weight
      26 kDa including tags
    • Amino acids
      1 to 203
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102696 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab102696 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 5730472O18Rik
    • dRalb
    • GTP binding protein
    • Ralb
    • RALB_HUMAN
    • RAS like protein B
    • RAS like proto oncogene B
    • Ras related GTP binding protein B
    • Ras-related protein Ral-B
    • V ral simian leukemia viral oncogene homolog B
    • v ral simian leukemia viral oncogene homolog B (ras related GTP binding protein)
    • v ral simian leukemia viral oncogene homolog B (ras related)
    see all
  • Function
    Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. Required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells. Plays a role in the late stages of cytokinesis and is required for the abscission of the bridge joining the sister cells emerging from mitosis. Required for suppression of apoptosis.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Ras family.
  • Post-translational
    modifications
    Prenylation is essential for membrane localization. The geranylgeranylated form and the farnesylated mutant does not undergo alternative prenylation in response to geranylgeranyltransferase I inhibitors (GGTIs) and farnesyltransferase I inhibitors (FTIs).
  • Cellular localization
    Cell membrane. During late cytokinesis localizes at the midbody.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab102696.

References

ab102696 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102696.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up