Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQV PVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSE
    • Amino acids
      89 to 183
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159308 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5730472O18Rik
    • dRalb
    • GTP binding protein
    • Ralb
    • RALB_HUMAN
    • RAS like protein B
    • RAS like proto oncogene B
    • Ras related GTP binding protein B
    • Ras-related protein Ral-B
    • V ral simian leukemia viral oncogene homolog B
    • v ral simian leukemia viral oncogene homolog B (ras related GTP binding protein)
    • v ral simian leukemia viral oncogene homolog B (ras related)
    see all
  • Function
    Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. Required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells. Plays a role in the late stages of cytokinesis and is required for the abscission of the bridge joining the sister cells emerging from mitosis. Required for suppression of apoptosis.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Ras family.
  • Post-translational
    modifications
    Prenylation is essential for membrane localization. The geranylgeranylated form and the farnesylated mutant does not undergo alternative prenylation in response to geranylgeranyltransferase I inhibitors (GGTIs) and farnesyltransferase I inhibitors (FTIs).
  • Cellular localization
    Cell membrane. During late cytokinesis localizes at the midbody.
  • Information by UniProt

Images

  • ab159308 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159308 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159308.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up