Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAG CSVHKGYAFVQYSNERHARAAVLGENGRVLAGQTLDINMAGEPKPDRPKG LKRAASAIYSGYIFDYDYYRDDFYDRLFDYRGRLSPVPVPRAVPVKRPRV TVPLVRRVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIKTELTQIKSN IDALLSRLEQIAAEQKANPDGKKKGDGGGASGGGGGGGGSGGGGSGGGGG GGSSRPPAPQENTTSEAGLPQGEARTRDDGDEEGLLTHSEEELEHSQDTD ADDGALQ
    • Amino acids
      1 to 307
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161475 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Autoantigen p542
    • Heterogeneous nuclear ribonucleoprotein C-like 2
    • hnRNP associated with lethal yellow protein homolog
    • hnRNP core protein C-like 2
    • MGC117312
    • P542
    • RALY
    • RALY_HUMAN
    • RNA binding protein (autoantigenic hnRNP associated with lethal yellow)
    • RNA binding protein (autoantigenic)
    • RNA binding protein autoantigenic (hnRNP associated with lethal yellow homolog (mouse))
    • RNA-binding protein Raly
    see all
  • Function
    Probable-RNA binding protein. Could be a heterogeneous nuclear ribonucleoprotein (hnRNP). May be involved in pre-mRNA splicing.
  • Tissue specificity
    Expressed in heart, brain, lung, liver, skeletal muscle, kidney and pancreas. Weakly expressed in placenta.
  • Sequence similarities
    Belongs to the RRM HNRPC family. RALY subfamily.
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161475 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161475 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161475.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up