Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHM AEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGS
    • Amino acids
      27 to 117
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160916 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcitonin receptor like receptor activity modifying protein 1
    • Calcitonin-receptor-like receptor activity-modifying protein 1
    • CRLR activity modifying protein 1
    • CRLR activity-modifying protein 1
    • Ramp1
    • RAMP1_HUMAN
    • receptor (calcitonin) activity modifying protein 1
    • Receptor (G protein coupled) activity modifying protein 1
    • Receptor activity modifying protein 1 [Precursor]
    • Receptor activity-modifying protein 1
    see all
  • Function
    Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for calcitonin-gene-related peptide (CGRP) together with CALCRL.
  • Tissue specificity
    Expressed in many tissues including the uterus, bladder, brain, pancreas and gastro-intestinal tract.
  • Sequence similarities
    Belongs to the RAMP family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160916 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160916 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160916.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up